Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence---------------QQCLENLSN--MQVCAPLV---------------LPGAVNPAPN----SNCCIALQATNKDCICNALRAATT----------------------FTTTCNLPSLDC----
1PSY Chain:A ((1-125))AEFMESKGEREGSSSQQCRQEVQRKDLSSCERYLRQSSSRRSTGEEVLRMPGDENQQQESQQLQQCCNQVKQVRDECQCEAIKYIAEDQIQQGQLHGEESERVAQRAGEIVSSCGVRCMRQTRTN


General information:
TITO was launched using:
RESULT:

Template: 1PSY.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -34672 for 439 contacts (-79.0/contact) +
2D Compatibility (PS) -6479 + (NN) -4060 + (LL) 0
1D Compatibility (HY) -4400 + (ID) 650
Total energy: -50261.0 ( -114.49 by residue)
QMean score : 0.449

(partial model without unconserved sides chains):
PDB file : Tito_1PSY.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1PSY-query.scw
PDB file : Tito_Scwrl_1PSY.pdb: