Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMQKQVVVMDEAAIKRALTRVSYEIIERNKGTKNLALVGIKTRGIYLAERLHKRILEIEGIDVPVGDIDITLYRDDLSFKDDKTREPAVHGTNIPFDINGKKVVLVDDVLYTGRTVRAAMDALMDVGRPAQIHLAVLADRGHRELPIRADYVGKNIPTSGNERVEVRLTDVDHAEDAVIINKNE
4P86 Chain:C ((4-181))--QKAVILDEQAIRRALTRIAHEMIERNKGMNNCILVGIKTRGIYLAKRLAERIEQIEGNPVTVGEIDITLYRDDLS-----NDEPLVKGADIPVDITDQKVILVDDVLYTGRTVRAGMDALVDVGRPSSIQLAVLVDRGHRELPIRADYIGKNIPTSKSEKVMVQLDEVDQ-NDLVAIYEN-


General information:
TITO was launched using:
RESULT:

Template: 4P86.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -108612 for 1376 contacts (-78.9/contact) +
2D Compatibility (PS) -19293 + (NN) -6863 + (LL) 684
1D Compatibility (HY) -20400 + (ID) 5950
Total energy: -160434.0 ( -116.59 by residue)
QMean score : 0.614

(partial model without unconserved sides chains):
PDB file : Tito_4P86.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-4P86-query.scw
PDB file : Tito_Scwrl_4P86.pdb: