Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MTHVKALAIKGIMTIIVLYLVLGLGFGFTFGDTLLMTIVLGVISYLLGDLYVLPKWNNMIATLADFGLAFLVIWLMGMPLSMGMTGGEVALAALFGAIVMAIGEYCFHFYMMSKEIGKKHYLETRTDS 4K7Q Chain:A ((341-423)) ---VKTLVEAIILVFLVMYLFLQ-----NFRATLIPTIAVPVV--LLGTF----------AVLAAFGFSINTLTMFGMVLAIGL--------------------------------------------

General information: TITO was launched using: RESULT: Template: 4K7Q.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 107 -28566 -266.97 -446.34 target 2D structure prediction score : 0.77 Monomeric hydrophicity matching model chain A : 0.62 3D Compatibility (PKB) : -266.97 2D Compatibility (Sec. Struct. Predict.) : 0.77 1D Compatibility (Hydrophobicity) : 0.62 QMean score : 0.115

(partial model without unconserved sides chains): PDB file : Tito_4K7Q.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4K7Q-query.scw PDB file : Tito_Scwrl_4K7Q.pdb: