Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKSIGVVRKVDELGRIVMPIELRRALDIAIKDSIEFFVDGDKIILKKYKPHGVCLMTGEITSENKEYGNGKITLSPEGAQLLLEEIQAALKE 1MVF Chain:D ((4-47)) ----SSVKRWGNSPAVRIPATLMQALNLNIDDEVKIDLVDGKLIIEPV--------------------------------------------

General information: TITO was launched using: RESULT: Template: 1MVF.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain D - contact count / total energy / energy per contact / energy per residue : 73 -14837 -203.25 -337.20 target 2D structure prediction score : 0.59 Monomeric hydrophicity matching model chain D : 0.65 3D Compatibility (PKB) : -203.25 2D Compatibility (Sec. Struct. Predict.) : 0.59 1D Compatibility (Hydrophobicity) : 0.65 QMean score : 0.403

(partial model without unconserved sides chains): PDB file : Tito_1MVF.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1MVF-query.scw PDB file : Tito_Scwrl_1MVF.pdb: