Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MTKVERLLINYKTLEEFKKFKEYGIQELSMLEELQDNIIENDSTSPFYGIYFGDKLVARMSLYQVNGKSNPYFDNRQDYLELWKLEVLPGYQNRGYGRALVEFAKSFK-----MPIRTNPRMK-SAEFWNKMNFKTVKYDMARDKGENPLIWHPDMDREMTPGESA 3FNC Chain:A ((62-147)) ----------------------------------------------FAVLEQADKVIGFANFIELE----------KGKSELAAFYLLPEVTQRGLGTELLEVGMTLFHVPLPMFVNVEKGNETAIHFYKAKGFVQVEEFTE------------------------

General information: TITO was launched using: RESULT: Template: 3FNC.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 248 -50743 -204.61 -634.29 target 2D structure prediction score : 0.59 Monomeric hydrophicity matching model chain A : 0.64 3D Compatibility (PKB) : -204.61 2D Compatibility (Sec. Struct. Predict.) : 0.59 1D Compatibility (Hydrophobicity) : 0.64 QMean score : 0.394

(partial model without unconserved sides chains): PDB file : Tito_3FNC.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3FNC-query.scw PDB file : Tito_Scwrl_3FNC.pdb: