Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MEMDITQYLSTQGPFAVLFCWLLFYVMKTSKERESKLYNQIDSQNEVLGKFSEKYDVVIEKLDKIEQNFK 3BBP Chain:D ((29-66)) ----------------------------KSADHLNGLLRETEATNAILMEQIKLLKSEIRRLERNQ----

General information: TITO was launched using: RESULT: Template: 3BBP.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain D - contact count / total energy / energy per contact / energy per residue : 1 80 80.00 2.11 target 2D structure prediction score : 0.82 Monomeric hydrophicity matching model chain D : 0.56 3D Compatibility (PKB) : 80.00 2D Compatibility (Sec. Struct. Predict.) : 0.82 1D Compatibility (Hydrophobicity) : 0.56 QMean score : 0.652

(partial model without unconserved sides chains): PDB file : Tito_3BBP.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3BBP-query.scw PDB file : Tito_Scwrl_3BBP.pdb: