Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MFSENLKKCRKQKKLTQQNMADKLGITRPAYTAYELGSREPDYKTLINISNILDVSLDYLLKGESNEKVFQDEAKKVLNDPETFLAAKDGEVTDEILQAALEIITEQLKERRKSDK 4I6U Chain:F ((16-66)) -----IKKIRLEKGMTQEDLAYKSNLDRTFISGIERNSRNLTIKSLELIMKGLEVS------------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 4I6U.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain F - contact count / total energy / energy per contact / energy per residue : 162 -17039 -105.18 -334.10 target 2D structure prediction score : 0.73 Monomeric hydrophicity matching model chain F : 0.69 3D Compatibility (PKB) : -105.18 2D Compatibility (Sec. Struct. Predict.) : 0.73 1D Compatibility (Hydrophobicity) : 0.69 QMean score : 0.708

(partial model without unconserved sides chains): PDB file : Tito_4I6U.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4I6U-query.scw PDB file : Tito_Scwrl_4I6U.pdb: