Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MMTGTLGTLVPIILMFAVLYFLLIRPQQKQQKAVRQMQEELKKGDSVVTIGGLHGTVDSIDESKVVIKTGDNTRLTFDRRAIREVSAAE 4NL2 Chain:D ((33-67)) ----------------------------------------------------LRGRVVSFDNFTVLLDVE-GKQQLVFKHAISTFSPQ-

General information: TITO was launched using: RESULT: Template: 4NL2.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain D - contact count / total energy / energy per contact / energy per residue : 81 -14993 -185.10 -428.37 target 2D structure prediction score : 0.63 Monomeric hydrophicity matching model chain D : 0.57 3D Compatibility (PKB) : -185.10 2D Compatibility (Sec. Struct. Predict.) : 0.63 1D Compatibility (Hydrophobicity) : 0.57 QMean score : 0.865

(partial model without unconserved sides chains): PDB file : Tito_4NL2.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4NL2-query.scw PDB file : Tito_Scwrl_4NL2.pdb: