Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence---------------------MFCTFFEKHHRKWDILLEKSTGVMEAMKVTSEEKEQLSTAIDRMNEGLDAFIQLYNESEIDEPLI-------QLDDDTAELMKQARDMYGQE--------KLNEKLNTIIKQILSISVSEEGEKE-
2KQ2 Chain:A ((1-147))MDDRTEYDVYTDGSYVNGQYAWAYAFVKDGKVHYEDADVGKNPAAATMRNVAGEIAAALYAVKKASQLGVKIRILHDYAGIAFWATGEWKAKNEFTQAYAKLMNQYRGIYSFEKVKAHSGNEFNDYVDMKAKSALGIRDLEHHHHHH


General information:
TITO was launched using:
RESULT:

Template: 2KQ2.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 341 13381 39.24 121.64
target 2D structure prediction score : 0.54
Monomeric hydrophicity matching model chain A : 0.66

3D Compatibility (PKB) : 39.24
2D Compatibility (Sec. Struct. Predict.) : 0.54
1D Compatibility (Hydrophobicity) : 0.66
QMean score : 0.249

(partial model without unconserved sides chains):
PDB file : Tito_2KQ2.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-2KQ2-query.scw
PDB file : Tito_Scwrl_2KQ2.pdb: