Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MVNQGSPQLVSLVDPYVYQTIKKLIG-SRFVIQT-V-RDTVRGRLIDVKPDHITIEGARNSVCLIRIQHMISVTPDYSERV 2GSV Chain:A ((3-69)) -------ELFS--VPYFIENLKQHIEMNQSEDKIHAMNSYYRSVVSTLVQDQLT----KNAVVLKRIQHLDEAYNKVKRG-

General information: TITO was launched using: RESULT: Template: 2GSV.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 161 647 4.02 10.10 target 2D structure prediction score : 0.41 Monomeric hydrophicity matching model chain A : 0.66 3D Compatibility (PKB) : 4.02 2D Compatibility (Sec. Struct. Predict.) : 0.41 1D Compatibility (Hydrophobicity) : 0.66 QMean score : 0.290

(partial model without unconserved sides chains): PDB file : Tito_2GSV.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2GSV-query.scw PDB file : Tito_Scwrl_2GSV.pdb: