Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMNIAVVTDSTAYIPKEMREQHQIHMIPLQVVFREETYREEIELDWKSFYEEVKKHNELPTTSQPPIGELVALYEELGK-SYDAVISIHLSSGISGTFSSAAAADSMVDNIDVYPFDSEISCLAQGFYALKAAELIKNGASSPEDIIKELEEMKKTVRAYFMVDDLAHLQRGGRLSSAQAFIGSLLKVKPILHFDNKVIVPFEKIRTRKKAISRIYELLDEDASKGLPMRAAVIHANREEEAAKIIEELSAKYPHVEFYNSYFGAVIGTHLGEGALGICWCFK
2G7Z Chain:A ((5-282))GTIKIVTDSSITIEPELIKALDITVVPLSVMIDSKLYSDNDLKEEGHFLSLMKASKSLPKTSQPPVGLFAETYENLVKKGVTDIVAIHLSPALSGTIEASRQGAEIA-EAPVTVLDSGFTDQAMKFQVVEAAKMAKAGAS-LNEILAAVQAIKSKTELYIGVSTLENLVKGGRIGRVTG-----LNVKVVMALKNDELKTLVKGRGNKTFTKWLDSYLAKNS-HRPIAEIAISYAGEASLALTLKERIAAYYNH-SISVLETGSIIQTHTGEGAFAVMVRYE


General information:
TITO was launched using:
RESULT:

Template: 2G7Z.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 1550 -73501 -47.42 -270.22
target 2D structure prediction score : 0.65
Monomeric hydrophicity matching model chain A : 0.74

3D Compatibility (PKB) : -47.42
2D Compatibility (Sec. Struct. Predict.) : 0.65
1D Compatibility (Hydrophobicity) : 0.74
QMean score : 0.539

(partial model without unconserved sides chains):
PDB file : Tito_2G7Z.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-2G7Z-query.scw
PDB file : Tito_Scwrl_2G7Z.pdb: