Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MNLIAAAIAIGLGALGAGIGNGLIVSRTVEGIARQPEAGKELRTLMFMGIALVEALPIIAVVIAFLAFFG 3V3C Chain:B ((7-74)) -SVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEDKIRGTLLLSLAFMEALTIYGLVVALALLF-

General information: TITO was launched using: RESULT: Template: 3V3C.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 140 -18098 -129.27 -266.15 target 2D structure prediction score : 0.79 Monomeric hydrophicity matching model chain B : 0.92 3D Compatibility (PKB) : -129.27 2D Compatibility (Sec. Struct. Predict.) : 0.79 1D Compatibility (Hydrophobicity) : 0.92 QMean score : 0.382

(partial model without unconserved sides chains): PDB file : Tito_3V3C.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3V3C-query.scw PDB file : Tito_Scwrl_3V3C.pdb: