Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKLIEERTYEERL----YIYSDDIEARKHFVSE--LKPKGWMVDNCWVGIDLNQ-------IKQFYRFKRELTDDYV-FNR-------- 3B4Q Chain:A ((4-93)) --LNSAPTPRDVVANAPAPVQAAVAGAQEYAAQAGLNTEELAVDALYNAIKVRLAGGIPPQIEAFYQANRTNFNGFYMANRGAIDFIFS

General information: TITO was launched using: RESULT: Template: 3B4Q.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 174 866 4.98 13.32 target 2D structure prediction score : 0.51 Monomeric hydrophicity matching model chain A : 0.67 3D Compatibility (PKB) : 4.98 2D Compatibility (Sec. Struct. Predict.) : 0.51 1D Compatibility (Hydrophobicity) : 0.67 QMean score : 0.311

(partial model without unconserved sides chains): PDB file : Tito_3B4Q.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3B4Q-query.scw PDB file : Tito_Scwrl_3B4Q.pdb: