Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence-------------QNCSAAIGELMTCGPYVLPGNNG-APSEQCCSALRAVNHGCLCETINIISS----------------------------------LPDHCSLPAVNCAA-------
1BEA Chain:? ((5-120))SCVPGWAIPHNPLPSCRWYVTS-RTCG--IGPRLPWPELKRRCCRELADIPAYCRCTALSILMDGAIPPGPDAQLEGRLEDLPGCPREVQRGFAATLVTEAECNLATISGVAECPWILG


General information:
TITO was launched using:
RESULT:

Template: 1BEA.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -28862 for 358 contacts (-80.6/contact) +
2D Compatibility (PS) -6389 + (NN) -1721 + (LL) 128
1D Compatibility (HY) -4400 + (ID) 700
Total energy: -41944.0 ( -117.16 by residue)
QMean score : 0.468

(partial model without unconserved sides chains):
PDB file : Tito_1BEA.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1BEA-query.scw
PDB file : Tito_Scwrl_1BEA.pdb: