Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence------------------------------------------------------------AGECGKTPIRSAAASLSPCLTAVGNVRASVP--------------PACCSKVGALIKTAPK-CLCAVLLS-PLAMQAGIKPG-IAITIPKRCNIKNRPVGKKCGRY-TVP--------
1TC1 Chain:A ((4-187))YEFAEKILFTEEEIRTRIKEVAKRIADDYKGKGLRPYVNPLVLISVLKGSFMFTADLCRALCDFN-VPVRMEFICVSSYVRMLLDTRHSIEGHHVLIVEDIVDTALTLNYLYHMYFTRRPASLKTVVLLDKREGRRVPFSADYVVANIPNA-FVIGYGLDYD-DTYRELRDIVVLRPE


General information:
TITO was launched using:
RESULT:

Template: 1TC1.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -29363 for 411 contacts (-71.4/contact) +
2D Compatibility (PS) -9205 + (NN) -2128 + (LL) 176
1D Compatibility (HY) -6000 + (ID) 600
Total energy: -47120.0 ( -114.65 by residue)
QMean score : 0.278

(partial model without unconserved sides chains):
PDB file : Tito_1TC1.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1TC1-query.scw
PDB file : Tito_Scwrl_1TC1.pdb: