Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence------------------------------------MTQEEIDQMIEDWISNGFP------DELKRLIPDEE-------------------------------------------------------
1Z67 Chain:A ((6-134))LFDEVVGAFLKGDAGKYQAILSWVEEQGGIQVLLEKLQSGGLGAILSTWLSNQQRNQSVSGEQLESALGTNAVSDLGQKLGVDTSTASSLLAEQLPKIIDALSPQGEVQANNDLLSAGMELLKGKLF


General information:
TITO was launched using:
RESULT:

Template: 1Z67.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -3705 for 136 contacts (-27.2/contact) +
2D Compatibility (PS) -3308 + (NN) -2977 + (LL) 0
1D Compatibility (HY) -2400 + (ID) 200
Total energy: -12590.0 ( -92.57 by residue)
QMean score : 0.546

(partial model without unconserved sides chains):
PDB file : Tito_1Z67.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1Z67-query.scw
PDB file : Tito_Scwrl_1Z67.pdb: