Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MDKQRIFEVLITNICEVLPELDGHRFEPEDQLVEL-GADSVDRAEIITMVLEDLSLKIPRIELSGVKNIGELAEVLYDKVQSA 2LML Chain:A ((5-76)) -------DALTPIFRQVF-DDDSIVLTRETSANDIDAWDSLSHMNLIVSLEVHYKIKFALGELQKLKNVGDLADLVDKKL---

General information: TITO was launched using: RESULT: Template: 2LML.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 237 -44233 -186.64 -622.99 target 2D structure prediction score : 0.52 Monomeric hydrophicity matching model chain A : 0.73 3D Compatibility (PKB) : -186.64 2D Compatibility (Sec. Struct. Predict.) : 0.52 1D Compatibility (Hydrophobicity) : 0.73 QMean score : 0.581

(partial model without unconserved sides chains): PDB file : Tito_2LML.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2LML-query.scw PDB file : Tito_Scwrl_2LML.pdb: