Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MNRNQAIIASLCYFSVFIAPIIVPIVAYFVVNEKETKRHAIRSLISHIVPFVGWLFLFIALLGGAVAIDGDSLLPVFVIIGGAVIYFLVVIGIIIWNVIQGIKVLRAA 3GNZ Chain:P ((168-189)) -------------------GKQQPLIQW----EQMT-QAARDALES--------------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 3GNZ.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain P - contact count / total energy / energy per contact / energy per residue : 15 -790 -52.63 -35.89 target 2D structure prediction score : 0.27 Monomeric hydrophicity matching model chain P : 0.37 3D Compatibility (PKB) : -52.63 2D Compatibility (Sec. Struct. Predict.) : 0.27 1D Compatibility (Hydrophobicity) : 0.37 QMean score : 0.675

(partial model without unconserved sides chains): PDB file : Tito_3GNZ.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3GNZ-query.scw PDB file : Tito_Scwrl_3GNZ.pdb: