Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MVPVETLHSGDPITDVNGGGQRYIVLESKTV----GDSCVVLELESRVNHQLQVIEKSFPAGYHVGRAHHRIL-------------------------------------------------------------------------------------------------------------------- 1UEB Chain:A ((1-184)) MISVTDLRPGTKVKM---DGGLWECVEYQHQKLGRGGAKVVAKFKNLETGA--TVERTFNSGEKLEDIYVETRELQYLYPEGEEMVFMDLETYEQFAVPRSRVVGAEFFKEGMTALGDMYEGQPIKVTPPTVVELKVVDTPPGVRGDTVSGGSKPATLETGAVVQVPLFVEPGEVIKVDTRTGEYVGRA

General information: TITO was launched using: RESULT: Template: 1UEB.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output 3D Compatibility (PKB) -11192 for 394 contacts (-28.4/contact) + 2D Compatibility (PS) -6935 + (NN) -133 + (LL) 236 1D Compatibility (HY) -2000 + (ID) 600 Total energy: -20624.0 ( -52.35 by residue) QMean score : 0.343

(partial model without unconserved sides chains): PDB file : Tito_1UEB.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1UEB-query.scw PDB file : Tito_Scwrl_1UEB.pdb: