Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMGDKIAVIPGTFDPITNGHLDIIERAAKIFDVLYVSVLNNSSKKPLFTIEERMEMIRQVTAHLPNVQVESASGLTVDYAATRGATAIVRGLRAVSDFEYEMQIASMNRTLNADIETFFVMTNTKYSFLSSSMVKEVAQYQGDISELVPEIVNKAVQAKFK
3PNB Chain:C ((24-176))-----AVCPGSFDPVTLGHVDIFERAAAQFDEVVVAILVNPAKTGMFDLDERIAMVKESTTHLPNLRVQVGHGLVVDFVRSCGMTAIVKGLRTGTDFEYELQMAQMNKHI-AGVDTFFVATAPRYSFVSSSLAKEVAMLGGDVSELLPEPVNRRLRDRL-


General information:
TITO was launched using:
RESULT:

Template: 3PNB.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -104627 for 1183 contacts (-88.4/contact) +
2D Compatibility (PS) -16825 + (NN) -9773 + (LL) 212
1D Compatibility (HY) -17200 + (ID) 3900
Total energy: -152113.0 ( -128.58 by residue)
QMean score : 0.598

(partial model without unconserved sides chains):
PDB file : Tito_3PNB.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-3PNB-query.scw
PDB file : Tito_Scwrl_3PNB.pdb: