Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMNKWKRLFFILLAINFILAAGFVALVLLPGEQAQVKDASESEYGFQVTSTKE---SLAAFVNSYLNDKASNKLDYKVEIDDDVHVAGK------IKAFSTSIDAFIAFEPTVKKNGDV-ELNVTKFSLGKLSIPIS------------FVLNYMDSFYELPSFVHVHPGDKS----IEVRLSEMPLTNGMYVKA---------------DKINLEKDEIEFSYYHPKQ------------------------------------
3TUR Chain:A ((29-286))---HLTMPYVMPGDGEVVGVGEPVAIRFDEN---IADRGAAEKAIKITTNPPVEGAFYWLNNREVRWRPEHFWKPGTAVDVAVNTYGVDLGEGMFGEDNVQTHFTIGDEVIATADDNTKILTVRVNGEVVKSMPTSMGKDSTPTANGIYIVGSRYKHIIMDSSTYGVPVNSPNGYRTDVDWATQISYSGVFVHSAPWSVGAQGHTNTSHGCLNVSPSNAQWFYDHVKRGDIVEVVNTVGGTLPGIDGLGDWNIPWDQWRAGNAK


General information:
TITO was launched using:
RESULT:

Template: 3TUR.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 734 5265 7.17 29.09
target 2D structure prediction score : 0.35
Monomeric hydrophicity matching model chain A : 0.62

3D Compatibility (PKB) : 7.17
2D Compatibility (Sec. Struct. Predict.) : 0.35
1D Compatibility (Hydrophobicity) : 0.62
QMean score : 0.110

(partial model without unconserved sides chains):
PDB file : Tito_3TUR.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-3TUR-query.scw
PDB file : Tito_Scwrl_3TUR.pdb: