Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MEQKLKAMKNTAQNKTWVSFLNQNHPYTLLHWSIGGAESIKKDVWLLQDEMTFETQEFTTIDLAIEWIRENMDGITDVL 1OWT Chain:A ((124-189)) -----SDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFR-GVEFVCCPL-------

General information: TITO was launched using: RESULT: Template: 1OWT.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 276 -25568 -92.64 -387.39 target 2D structure prediction score : 0.29 Monomeric hydrophicity matching model chain A : 0.62 3D Compatibility (PKB) : -92.64 2D Compatibility (Sec. Struct. Predict.) : 0.29 1D Compatibility (Hydrophobicity) : 0.62 QMean score : 0.053

(partial model without unconserved sides chains): PDB file : Tito_1OWT.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1OWT-query.scw PDB file : Tito_Scwrl_1OWT.pdb: