Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMRIGHGYDVHRFGEGDFITLGGVRIPHKHGLVAHSDGDVLLHALSDALLGAAALGDIGKHFPDTDPRFKGADSRALLRHVVAIVAEKGWKVGNVDATIVAQAPKMAPHIETMRGLIAEDLGVAVDQVNVKATTTERLGFTGREEGIAVHAVALLMAR
1H48 Chain:C ((3-157))MRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLI--


General information:
TITO was launched using:
RESULT:

Template: 1H48.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -118260 for 1320 contacts (-89.6/contact) +
2D Compatibility (PS) -17147 + (NN) -12177 + (LL) 244
1D Compatibility (HY) -17200 + (ID) 5550
Total energy: -170090.0 ( -128.86 by residue)
QMean score : 0.519

(partial model without unconserved sides chains):
PDB file : Tito_1H48.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1H48-query.scw
PDB file : Tito_Scwrl_1H48.pdb: