Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MLKKVILAAFILVGSTLGAFSFSSDASAKHVNGNITWYNGVGKKGSSGKKLGHWDCATKIGFDVPRNGTKIRAYAKAKPKKVITV-YKNDVGRMPNAVLDVSPKAFKALGYP-L-SKGKVAGHYSY 3M3G Chain:A ((52-112)) ----------------------------------------------------------VAGWNSASCGTCWKLQY-SGHTIYVLAVDHA----ASG--FNIALDAMNALTGGQAVQLGRVSATATQ

General information: TITO was launched using: RESULT: Template: 3M3G.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 184 -21561 -117.18 -371.74 target 2D structure prediction score : 0.76 Monomeric hydrophicity matching model chain A : 0.58 3D Compatibility (PKB) : -117.18 2D Compatibility (Sec. Struct. Predict.) : 0.76 1D Compatibility (Hydrophobicity) : 0.58 QMean score : 0.630

(partial model without unconserved sides chains): PDB file : Tito_3M3G.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3M3G-query.scw PDB file : Tito_Scwrl_3M3G.pdb: