Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence ----------MK--LIEERTYEERLYIYSDDIEARKHFVSELKPKG-WMVDN------------CWVGIDLNQIKQFYRFKRELTDDYVFNR- 4U3Q Chain:A ((10-130)) KAKAEKVECALKGGIFRGTLPIDTTVTFNADGTAQKVELSPLTYRGTWMVREDGIVELSLVEKELYELIDSNSVRYMGAPGAEMAPFYVLKKT

General information: TITO was launched using: RESULT: Template: 4U3Q.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 254 5098 20.07 76.09 target 2D structure prediction score : 0.46 Monomeric hydrophicity matching model chain A : 0.69 3D Compatibility (PKB) : 20.07 2D Compatibility (Sec. Struct. Predict.) : 0.46 1D Compatibility (Hydrophobicity) : 0.69 QMean score : 0.157

(partial model without unconserved sides chains): PDB file : Tito_4U3Q.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4U3Q-query.scw PDB file : Tito_Scwrl_4U3Q.pdb: