Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence-------------QQCLDNLSNMQVCAPLVLPGAVNPAPNSNCCIALQATNKDCICNALRAATT----------------------------------FTTTCNLPSLD----C-----
1BEA Chain:? ((5-120))SCVPGWAIPHNPLPSCRWYVTS-RTCG--IGPRLPWPELKRRCCRELADIPAYCRCTALSILMDGAIPPGPDAQLEGRLEDLPGCPREVQRGFAATLVTEAECNLATISGVAECPWILG


General information:
TITO was launched using:
RESULT:

Template: 1BEA.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -15811 for 355 contacts (-44.5/contact) +
2D Compatibility (PS) -6154 + (NN) -866 + (LL) 244
1D Compatibility (HY) -2800 + (ID) 750
Total energy: -26137.0 ( -73.63 by residue)
QMean score : 0.365

(partial model without unconserved sides chains):
PDB file : Tito_1BEA.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1BEA-query.scw
PDB file : Tito_Scwrl_1BEA.pdb: