Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceQSCPQTITFSPCLTNVGNTGTPPAYDSQCCKLVRDPKWTDQCLCAVVSSHFPGVDETKALNLAHDCGRRVPKGIYCDGRPVPP
M036 Chain:A ((3-121))QSCPQTITFSPCLTNVGNTGTPPAYDSQCCKLVRDPKWTDQCLCAVVSSHFPGVDETKALNLAHDCGRRVPKGIYCDGRPVPP


General information:
TITO was launched using:
RESULT:

Template: M036.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -1208 for 576 contacts (-2.1/contact) +
2D Compatibility (PS) -8249 + (NN) -3250 + (LL) 0
1D Compatibility (HY) 6000 + (ID) 250
Total energy: -6957.0 ( -12.08 by residue)
QMean score : -0.055

(partial model without unconserved sides chains):
PDB file : Tito_M036.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-M036-query.scw
PDB file : Tito_Scwrl_M036.pdb: