Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMVKTWEEFLKQEAKQPYFIELMEAVKDARAKGNVYPSEEDMFSCFRLCPYNQVKVVILGQDPYHGPGQAHGLSFSVQKDVRIPPSLRNIYKELKTDLD-IEPADHGYLAKWAEQGVLLMNTSWSVEEGKAGSHKKLGWATFTDHVLEELNNYDKPLVFILWGNHAIKAASGITNPQHLIIKGVHPSPLAASRGFFGSKPFSKTNAFLEEHERKPIDWDLNEQ
1OKB Chain:B ((6-220))--ETWRRELAAEFEKPYFKQLMSFVADERSRHTVYPPADQVYSWTEMCDIQDVKVVILGQDPYHGPNQAHGLCFSVQKPVPPPPSLVNIYKELCTDIDGFKHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSHKDRGWETFTDAVIKWLSVNREGVVFLLWGSYAHKKGATIDRKRHHVLQAVHPSPLSAHRGFLGCKHFSKANGLLKLSGTEPINW-----


General information:
TITO was launched using:
RESULT:

Template: 1OKB.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -101308 for 1744 contacts (-58.1/contact) +
2D Compatibility (PS) -23173 + (NN) -11399 + (LL) 644
1D Compatibility (HY) -21200 + (ID) 5400
Total energy: -161836.0 ( -92.80 by residue)
QMean score : 0.694

(partial model without unconserved sides chains):
PDB file : Tito_1OKB.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1OKB-query.scw
PDB file : Tito_Scwrl_1OKB.pdb: