Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MDSYKVIELANKYSAAAEEVRSSKMLLESRLSALGDAWQGKARDSFDQDFEETKAAYDQFEQELLETSQELKAAAVKIEERKAEIARMEELERKAREERHKLGR 3FAV Chain:A ((12-85)) -----LAQEAGNFERISGDLKTQIDQVESTAGSLQGQWRGAAGTAAQAAVVRFQEAANKQKQELDEISTNIRQAGVQYS-------------------------

General information: TITO was launched using: RESULT: Template: 3FAV.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 101 -9281 -91.89 -125.41 target 2D structure prediction score : 0.81 Monomeric hydrophicity matching model chain A : 0.73 3D Compatibility (PKB) : -91.89 2D Compatibility (Sec. Struct. Predict.) : 0.81 1D Compatibility (Hydrophobicity) : 0.73 QMean score : 0.723

(partial model without unconserved sides chains): PDB file : Tito_3FAV.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3FAV-query.scw PDB file : Tito_Scwrl_3FAV.pdb: