Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MAIIIAIIAAVIVIAALITFNVRNASPGPEKQEATDRIAPPEEEKNEAHYPAEARAAEHTPSVVKNDSPKEKRDTMGDDIYRQALQKFKHSDEVHAEEEVTEESDKMQDRSYRDALLSMKNKKK 2M5E Chain:B ((1-26)) ------------------------------------------------------------------------------------------------KRKQEEVSAIVIQRAYRRYLLKQKVK--

General information: TITO was launched using: RESULT: Template: 2M5E.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 7 834 119.14 32.08 target 2D structure prediction score : 0.77 Monomeric hydrophicity matching model chain B : 0.61 3D Compatibility (PKB) : 119.14 2D Compatibility (Sec. Struct. Predict.) : 0.77 1D Compatibility (Hydrophobicity) : 0.61 QMean score : 0.878

(partial model without unconserved sides chains): PDB file : Tito_2M5E.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2M5E-query.scw PDB file : Tito_Scwrl_2M5E.pdb: