Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MHDYIKERTIKIG--KYIVETKKTVRVIAKEFGVSKSTVHKDLTERLPEINPDLANEVKEILDYHKSIRHLRGGEATKLKYKKDEILEGEPVQQS 2X48 Chain:A ((1-54)) -----MKKEIQVQGVRYYVESEDDLVSVAHELAKMGYT--------VQQIANALGVSERKVRRYLES----------------------------

General information: TITO was launched using: RESULT: Template: 2X48.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 182 16606 91.24 319.35 target 2D structure prediction score : 0.40 Monomeric hydrophicity matching model chain A : 0.68 3D Compatibility (PKB) : 91.24 2D Compatibility (Sec. Struct. Predict.) : 0.40 1D Compatibility (Hydrophobicity) : 0.68 QMean score : 0.468

(partial model without unconserved sides chains): PDB file : Tito_2X48.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2X48-query.scw PDB file : Tito_Scwrl_2X48.pdb: