Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence-------------MF-QTL-DHFLKSWEFEADATQKLLNSLTDESLKQEITSQNWTLGRIAWHTVAAIGIITSNTDLTFQAPAEDYPVPTSAQF-------------IADSYHQASNAFVQALKTQWTDHTLQERINFIGQ--QMPNGSLLMFLIQHQNHHRGQMTVL-MRQAGLTVPGIYGPAKEEWAKFGLEAPKM
2RD9 Chain:A ((5-193))KIHHHHHHENLYFQGMNFQMNEAIQLLERTPKTLEVFLEGLSDSWHQCNEGYETWTVYEVVVHLIEAEKTNWIPRLRFILQEGEHKPFPAFDRFSHLNQSNAVPISERFKEFQQLRKENLNTLRSLVQSEADLERTGAHPAFGVVKVRELLSAWVVHDLTHIAQIVRSMAKRYDTDV----GPWKEYLGILND-----


General information:
TITO was launched using:
RESULT:

Template: 2RD9.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 475 11618 24.46 73.53
target 2D structure prediction score : 0.42
Monomeric hydrophicity matching model chain A : 0.64

3D Compatibility (PKB) : 24.46
2D Compatibility (Sec. Struct. Predict.) : 0.42
1D Compatibility (Hydrophobicity) : 0.64
QMean score : 0.349

(partial model without unconserved sides chains):
PDB file : Tito_2RD9.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-2RD9-query.scw
PDB file : Tito_Scwrl_2RD9.pdb: