Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence---------------------------------------------------------------------MFLVVTLPFMIFFNNEVGNYKVQFSYGCVYYATNEYVHA--GDKFYSNYFIDSHYGREINMYPQSELLAKGYVGNTLPILISLDKDLIK-------------------------------------------------------------------------------------------------------------------------------
4PHR Chain:A ((1-277))SEFELMKRLSEIKVLPILESLKYIKHNHASVVRFGDGEIDLMTGHSIPYQDYNEKLAKRLQQILQTKSDEKLLVCLPD-VFSNMDRYNQNARHFWERHFLKYSEFYLNCCDAPFYGSTFISRPYIDLIDKSP-----SEAYFESLKELWRG--KDLLIVEGATSRSGVGNDLFVAASSIKRLVCPSKNAFQYYDEILRLTEKNAKNRLILVMLGPTAKVLVADLTTKGYQAIDLGHIDSEYEWYEMGATYKVKLTNKHTAEFNYDEGIELEFSQEYQEQIVARIG


General information:
TITO was launched using:
RESULT:

Template: 4PHR.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -18342 for 396 contacts (-46.3/contact) +
2D Compatibility (PS) -7892 + (NN) 3053 + (LL) 856
1D Compatibility (HY) -3200 + (ID) 950
Total energy: -26475.0 ( -66.86 by residue)
QMean score : -0.088

(partial model without unconserved sides chains):
PDB file : Tito_4PHR.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-4PHR-query.scw
PDB file : Tito_Scwrl_4PHR.pdb: