Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence------------------------------------------------------------------------------------------------------------------MNKLVLSTLSVAAMGMVIFSGGTAYAADKEGN---TVVEYSVEGDYTLVVP---EKVNLSNDNATEMSVKTINRNLEPGKEVEVTLSSGLSADGEIELERVGAT---SDVITSSFKSNNSTVTMANPVIGSFSGYAIEETEVSKIQIGSPQGDKKAGAYQTTLTFTAAFK-------------------------------------------------------------------------------------------
4IC4 Chain:A ((26-397))KSVTRRNDIPEAAASPPSLLSFLRKNVGKDLSSIAMPVTSNEPISILQLISETFEYAPLLTKATQRPDPITFVSAFAISFLSIYRDKTRTLRKPFNPLLAETFELIREDMGFRLISEKVSHRPPVFAFFAEHLDWECSYTVTPSQKFWGKSIELNNEGILRLKFKTTGELFEWTQPTTILKNLIAGERYMEPVNEFEVHSSKG--DKSHILFDKAGMFSGRSEGFKVSIIPPPSSNRKKETLAGKWTQSLANETTHETIWEVGDLVSNPKKKYGFT-KFTANLNEITEIEKGNLPPTDSRLRPDIRAYEEGNVDKAEEWKLKLEQLQRERRNKGQDVEPKYFEKVSKNEWKYITGPKSYWERRKKHDWSDISQLW


General information:
TITO was launched using:
RESULT:

Template: 4IC4.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) 11676 for 926 contacts (12.6/contact) +
2D Compatibility (PS) -16039 + (NN) 4774 + (LL) 324
1D Compatibility (HY) -2400 + (ID) 1550
Total energy: -3215.0 ( -3.47 by residue)
QMean score : 0.177

(partial model without unconserved sides chains):
PDB file : Tito_4IC4.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-4IC4-query.scw
PDB file : Tito_Scwrl_4IC4.pdb: