Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMNKVVVKNVTFGEGAPKICVPMVGKTVAALKEEAEMLQTIDLDVVEWRVDFFEDVKDLAKVEAALGEIRAILPETPILFTFRSAKEGGELAVSDEFYFELNETLAGTGKIDLVDVELFNEEADVLRLIETAHKNNVKVVMSNHDFDKTPAKEEIVSRLTRMEALGADLPKIAVMPKSAGDVLTLLDATNTVFEK-ANQPIITMSMAGTGVISRLAGEVFGSAMTFGAAKKASAPGQIDVNELRHVLDLLHKQF
3M7W Chain:B ((5-254))-KTVTVRDLVVGEGAPKIIVSLMGKTITDVKSEALAYREADFDILEWRVDHFANVTTAESVLEAAGAIREIITDKPLLFTFRSAKEGGEQALTTGQYIDLNRAAVDSGLVDMIDLELFTGDDEVKATVGYAHQHNVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPKIAVMPQTKADVLTLLTATVEMQERYADRPIITMSMSKTGVISRLAGEVFGSAATFGAVKKASAPGQISVADLRTVLTILHQ--


General information:
TITO was launched using:
RESULT:

Template: 3M7W.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -140406 for 2171 contacts (-64.7/contact) +
2D Compatibility (PS) -27115 + (NN) -10298 + (LL) 460
1D Compatibility (HY) -24800 + (ID) 7000
Total energy: -209159.0 ( -96.34 by residue)
QMean score : 0.619

(partial model without unconserved sides chains):
PDB file : Tito_3M7W.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-3M7W-query.scw
PDB file : Tito_Scwrl_3M7W.pdb: