Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence-------------------------------------------------MRIMKFFKDVGKEMKKVSWPKGKELTRYTITVISTVIFFVIFFALLDTGISQLIRLIVE------------------------
1ML8 Chain:A ((1-134))MQARVKWVEGLTFLGESASGHQILMDGNSGDKAPSPMEMVLMAAGGCSAIDVVSILQKGRQDVVDCEVKLTSERRERLFTHI-NLHFIVTGRDLKDAAVARAVDLSAEKYCSVALMLEKAVNITHSYEVVAA


General information:
TITO was launched using:
RESULT:

Template: 1ML8.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -53276 for 327 contacts (-162.9/contact) +
2D Compatibility (PS) -6293 + (NN) -475 + (LL) -28
1D Compatibility (HY) -2400 + (ID) 450
Total energy: -62922.0 ( -192.42 by residue)
QMean score : 0.566

(partial model without unconserved sides chains):
PDB file : Tito_1ML8.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1ML8-query.scw
PDB file : Tito_Scwrl_1ML8.pdb: