Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence-----------------------------------------------------------------------------------------------------MRREERNMDKLLISFLLSLFMV-YFPPSDVVLPSQFEASTDSYVPMSSYPQETQSAKTPSPGSMHPAELIKEYSPLAQSVRQLSVKPLDEPLINRLEKALAVPVKYQSNYLRI-
3KFO Chain:A ((69-281))KIQYNLDTIDAEKNISNKLKKGEVQICKRFKNGSIREVFNILVEELKSTTVVNLSDLVELYSMLDDEESLFIPLRLLSVDGNLLNFEVKKFLNALVWRRIVLLNASNEGDKLLQHIVKRVFDEELPKNNDFPLPSVDLLCDKSLLTPEYISETYGRF--PIDQNAIREEIYEEISQVETLNSDNSLEIKLHSTIGSVAKEKNYTINYETNTVEYE


General information:
TITO was launched using:
RESULT:

Template: 3KFO.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 305 -29812 -97.74 -271.01
target 2D structure prediction score : 0.63
Monomeric hydrophicity matching model chain A : 0.60

3D Compatibility (PKB) : -97.74
2D Compatibility (Sec. Struct. Predict.) : 0.63
1D Compatibility (Hydrophobicity) : 0.60
QMean score : 0.285

(partial model without unconserved sides chains):
PDB file : Tito_3KFO.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-3KFO-query.scw
PDB file : Tito_Scwrl_3KFO.pdb: