Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MGIKQYSQEELKEMALVEIAHELFEE-HKKPVPFQELLNEIASLLGVKKEELGDRIAQFYTDLNIDGRFLALS--------DQTWGLRSWYPYDQLDEETQPTVKAKKKKAKKAVEEDLDLDEFEEIDEDDLDLDEVEEELDLEADDFDEEDLDEDDDDLEIEEDIIDEDDEDYDDEEEEIK 1VTN Chain:C ((5-82)) ------------PYSYISLITMAIQQAPGKMLTLSEIYQWIMDLFPYYRENQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWALHPS--------------------------------------------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 1VTN.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 174 -25218 -144.93 -365.48 target 2D structure prediction score : 0.70 Monomeric hydrophicity matching model chain C : 0.71 3D Compatibility (PKB) : -144.93 2D Compatibility (Sec. Struct. Predict.) : 0.70 1D Compatibility (Hydrophobicity) : 0.71 QMean score : 0.548

(partial model without unconserved sides chains): PDB file : Tito_1VTN.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1VTN-query.scw PDB file : Tito_Scwrl_1VTN.pdb: