Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence--------------------------------------------------------MAVPDRRVSKTRAAKRRTHYSVKLAKPVKAKDGTWK-LPHHINKFTKEY---------------------------------------------------------------------------------------------------------
4O6Y Chain:A ((10-219))PIFMVVRVLGFIIAALVLTWTVHYRGGLALSSDNKDHIFNVHPVMMVIGLILFNGEAMLAYKSVQGTKNLKKLVHLTLQLTAFILSLIGVWAALKFHIDKGIENFYSLHSWLGLACLFLFAFQWAAGFVTYWYPGGSRNSRASLMPWHVFLGISIYALALVTATTGILEKVTFLQVNQVITRYSTEAMLVNTMGVLILILGGFVILGVVT


General information:
TITO was launched using:
RESULT:

Template: 4O6Y.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) 10697 for 219 contacts (48.8/contact) +
2D Compatibility (PS) -5056 + (NN) -1931 + (LL) 0
1D Compatibility (HY) -3200 + (ID) 550
Total energy: -40.0 ( -0.18 by residue)
QMean score : 0.197

(partial model without unconserved sides chains):
PDB file : Tito_4O6Y.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-4O6Y-query.scw
PDB file : Tito_Scwrl_4O6Y.pdb: