Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MEEALKENIMGALEQVVDPELGVDIVNLGLVYDVDMDEDGLTHITMTLTSMGCP-LAPIIVDEVKKALAD-LPEVKDTEVHIVWNPPWTRDKMSRYAKIALGIQ 2Z51 Chain:A ((1-72)) MVPLTEENVESVLDE-IRPYLMS---DGGNVALHEID-GNVVRVKLQGACGSCPSSTMTMKMGIERRLMEKIPEIVA---------------------------

General information: TITO was launched using: RESULT: Template: 2Z51.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 241 -39744 -164.91 -567.76 target 2D structure prediction score : 0.80 Monomeric hydrophicity matching model chain A : 0.64 3D Compatibility (PKB) : -164.91 2D Compatibility (Sec. Struct. Predict.) : 0.80 1D Compatibility (Hydrophobicity) : 0.64 QMean score : 0.581

(partial model without unconserved sides chains): PDB file : Tito_2Z51.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2Z51-query.scw PDB file : Tito_Scwrl_2Z51.pdb: