Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMKKTIGFIGLGVMGKSMASHILNDGHPVLVYTRTKEKAESILQKGAIWKDTVKDLSKEADVIITMVGYPSDVEEVYFGSNGIIENAKEGAYLIDMTTSKPSLAKKIAEAAKEKALFALDAPVSGGDIGAQNGTLAIMVGGEKEAFEACMPIFSLMGENIQYQGPAGSGQHTKMCNQIAIAAGMIGVAEAMAYAQKSGLEPENVLKSITTGAAGSWSLSNLAPRMLQGNFEPGFYVKHFIKDMGIALEEAELMGEEMPGLSLAKSLYDKLAAQGEENSGTQSIYKLWVK
3PEF Chain:A ((1-286))-SQKFGFIGLGIMGSAMAKNLVKAGCSVTIWNRSPEKAEELAALGAERAATPCEVVESCPVTFAMLADPAAAEEVCFGKHGVLEGIGEGRGYVDMSTVDPATSQRIGVAVVAKGGRFLEAPVSGSKKPAEDGTLIILAAGDRNLYDEAMPGFEKMGKKIIHLGDVGKGAEMKLVVNMVMGGMMACFCEGLALGEKAGLATDAILDVIGAGAMANPMFALKGGLIRDRNFAPAFPLKHMQKDLRLAVALGDRVGQPLVASAAANELFKGARAAGFGDEDFSAIFKTYE-


General information:
TITO was launched using:
RESULT:

Template: 3PEF.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 1629 -174117 -106.89 -608.80
target 2D structure prediction score : 0.77
Monomeric hydrophicity matching model chain A : 0.79

3D Compatibility (PKB) : -106.89
2D Compatibility (Sec. Struct. Predict.) : 0.77
1D Compatibility (Hydrophobicity) : 0.79
QMean score : 0.564

(partial model without unconserved sides chains):
PDB file : Tito_3PEF.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-3PEF-query.scw
PDB file : Tito_Scwrl_3PEF.pdb: