Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MTDQHLEDLIVHIVTPLVDHPDDIRVIREETDQKIALRLSVHKSDTGKVIGKQGRTAKAIRTAVFAAGVQSSKKVQFEIFD 2CXC Chain:A ((36-67)) ----------------------------------NRLIFLVSEGEAGRAIGRGGRLIKLLREALGK---------------

General information: TITO was launched using: RESULT: Template: 2CXC.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 41 -7853 -191.52 -245.39 target 2D structure prediction score : 0.72 Monomeric hydrophicity matching model chain A : 0.64 3D Compatibility (PKB) : -191.52 2D Compatibility (Sec. Struct. Predict.) : 0.72 1D Compatibility (Hydrophobicity) : 0.64 QMean score : 0.469

(partial model without unconserved sides chains): PDB file : Tito_2CXC.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2CXC-query.scw PDB file : Tito_Scwrl_2CXC.pdb: