Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MFKDKNKIIKSVEKINKLEEGLSLFEEGDEEYLSVLVKIQGLYDEISDTALECFKEMTTKIRKTGQKRIIKGIDQLPHTIKENIADQVNDFKGGAI 5EQZ Chain:A ((46-104)) ----GGKFKDYKDKINELKENLKDIGNA--ELKEKLLNLQNSFQDKLAAKLAALKAAKNTIENIT-------------------------------

General information: TITO was launched using: RESULT: Template: 5EQZ.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 57 -9783 -171.62 -165.81 target 2D structure prediction score : 0.85 Monomeric hydrophicity matching model chain A : 0.69 3D Compatibility (PKB) : -171.62 2D Compatibility (Sec. Struct. Predict.) : 0.85 1D Compatibility (Hydrophobicity) : 0.69 QMean score : 0.586

(partial model without unconserved sides chains): PDB file : Tito_5EQZ.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5EQZ-query.scw PDB file : Tito_Scwrl_5EQZ.pdb: