Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKEKEFQSKPLLTKREREVFELLVQDKTTKEIASELFISEKTVRNHISNAMQKLGVKGRSQAVVELLRMGELEL 4WT0 Chain:A ((7-65)) -----------LTNREHEILMLIAQGKSNQEIADELFITLKTVKTHVSNILAKLDVDNRTQAAIYAFQHG----

General information: TITO was launched using: RESULT: Template: 4WT0.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 189 -30898 -163.48 -523.69 target 2D structure prediction score : 0.92 Monomeric hydrophicity matching model chain A : 0.79 3D Compatibility (PKB) : -163.48 2D Compatibility (Sec. Struct. Predict.) : 0.92 1D Compatibility (Hydrophobicity) : 0.79 QMean score : 0.796

(partial model without unconserved sides chains): PDB file : Tito_4WT0.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4WT0-query.scw PDB file : Tito_Scwrl_4WT0.pdb: