Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKTKVVMCSGLFCSVFAGAFMLNQYDGRSGVAACDEWELYLLEHHLSARMSETESKDLPFGPREYIRIVNK 3KXY Chain:T ((17-81)) -TEAVGHFEG--RSVTRAA---VRGEDRSSVAGLARWLARNVAGDPRSEQALQRLADGDGTPLEARTVRRR

General information: TITO was launched using: RESULT: Template: 3KXY.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain T - contact count / total energy / energy per contact / energy per residue : 87 151 1.74 2.32 target 2D structure prediction score : 0.45 Monomeric hydrophicity matching model chain T : 0.59 3D Compatibility (PKB) : 1.74 2D Compatibility (Sec. Struct. Predict.) : 0.45 1D Compatibility (Hydrophobicity) : 0.59 QMean score : 0.007

(partial model without unconserved sides chains): PDB file : Tito_3KXY.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3KXY-query.scw PDB file : Tito_Scwrl_3KXY.pdb: