Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MNINIVTIGKLKEKYLKQGIEEYTKRLSAYAKIDIIELPDEKAPENLSDQDMKIIKDKEGDRILSKISPDAHVIALAIEGKMK-----TSEELADTIDKLATYGKSKVTFVIGG-SLGLSDTVMKRADEKLSFSKMTFPHQLMRLILVEQIYRAFRINRGEPYHK 3ONP Chain:A ((73-136)) --------------------------------------------------------------------DCDYVFATTARGRELTKPVMTPERAMAHGRALTG-EGRRVGILFGPERTGLENEDVALANAIVTV--------------------------------

General information: TITO was launched using: RESULT: Template: 3ONP.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 164 -1659 -10.12 -28.60 target 2D structure prediction score : 0.88 Monomeric hydrophicity matching model chain A : 0.60 3D Compatibility (PKB) : -10.12 2D Compatibility (Sec. Struct. Predict.) : 0.88 1D Compatibility (Hydrophobicity) : 0.60 QMean score : 0.644

(partial model without unconserved sides chains): PDB file : Tito_3ONP.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3ONP-query.scw PDB file : Tito_Scwrl_3ONP.pdb: