Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceAISCGQVTSALSPCISYARGNGANPTAACCSGVRSLAGAARSTADKQAACKCIKSAAGGLNAGKAAGIPSKCGVSVPYAISAKVDCSKIR
M039 Chain:A ((1-127))AISCGQVTSALSPCISYARGNGANPTAACCSGVRSLAGAARSTADKQAACKCIKSAAGGLNAGKAAGIPSKCGVSVPYAISAKVDCSKIR


General information:
TITO was launched using:
RESULT:

Template: M039.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -47177 for 638 contacts (-73.9/contact) +
2D Compatibility (PS) -9389 + (NN) -2940 + (LL) 0
1D Compatibility (HY) -9600 + (ID) 4500
Total energy: -73606.0 ( -115.37 by residue)
QMean score : 0.622

(partial model without unconserved sides chains):
PDB file : Tito_M039.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-M039-query.scw
PDB file : Tito_Scwrl_M039.pdb: