Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMKTKLILLYGGKSAEHEVSLQTAFSVINALDLE-KFEAAPIYITNEGEWIQGPLLSGKLDFVEQLRFSATDTIKLATTESEKSEGEAISPAVLEADGQETVVFPLLHGPNGEDGTVQGLFEVLNIPYVGNGVLASSAAMDKIVMKKIFADAGIPQVPAVAVRLIDWKNYQ-EEMVAEMEEVLTYPVFVKPANLGSSVGISKATNKKELVDAMTEAFLYDRRVVVEQGVV-AREIEMGVLGNDTPVCS-VPGEILP-EGAVATFYDYKAKYQDNNTALI-IPTEVDPEILEQMKEYAIQAFLGLDASGLVRADFFLTEDNQLFLNEVNTMPGFTPYSMYPLLWQETGLPYGALIERLVDLAKERHAAKNALKYKLED
1EHI Chain:A ((3-362))-KKRVALIFGGNSSEHDVSKRSAQNFYNAIEATGKYEIIVFAIAQNGFFLDTES-SKKI-----LALEDEQPIVDAFMKTVDASDPLARIHALKSAGDFDIFFPVVHGNLGEDGTLQGLFKLLDKPYVGAPLRGHAVSFDKALTKELLTVNGIRNTKYIVVDPESANNWSWDKIVAELGNI----VFVKAANQGSSVGISRVTNAEEYTEALSDSFQYDYKVLIEEAVNGARELEVGVIGNDQPLVSEIGAHTVPNQGSGDGWYDYNNKFVDNSAVHFQIPAQLSPEVTKEVKQMALDAYKVLNLRGEARMDFLLDENNVPYLGEPNTLPGFTNMSLFKRLWDYSDINNAKLVDMLIDYGFEDFAQNKKLS-----


General information:
TITO was launched using:
RESULT:

Template: 1EHI.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -166049 for 2941 contacts (-56.5/contact) +
2D Compatibility (PS) -38878 + (NN) -19955 + (LL) 1396
1D Compatibility (HY) -25600 + (ID) 6250
Total energy: -255336.0 ( -86.82 by residue)
QMean score : 0.512

(partial model without unconserved sides chains):
PDB file : Tito_1EHI.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1EHI-query.scw
PDB file : Tito_Scwrl_1EHI.pdb: