Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MEDAGLLLIRIMIGVVFLFYGTQKLFGWFGGYGIKGTGQWFESIGVKPGNVAAALSGLGELVSGILFILGVFLPLGAAIITIIMLGAIVKVHGAKGFANGAGGFEYNLVLIAVSIGVALIGSGAYALHF 2AMN Chain:A ((4-23)) --RVWPLVIRTVIAGYNLYRAI-----------------------------------------------------------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 2AMN.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 20 -4501 -225.05 -225.05 target 2D structure prediction score : 0.50 Monomeric hydrophicity matching model chain A : 0.41 3D Compatibility (PKB) : -225.05 2D Compatibility (Sec. Struct. Predict.) : 0.50 1D Compatibility (Hydrophobicity) : 0.41 QMean score : -0.083

(partial model without unconserved sides chains): PDB file : Tito_2AMN.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2AMN-query.scw PDB file : Tito_Scwrl_2AMN.pdb: