Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MLAVNFTAFFYNLNISNLTRQVNKMKMDELEKVMIVEGKSDKEKIESVLNEPMRIICTNGTISQLRLEELADELYDKDVYILVDADESGEKLRKQLKREFNEACHLHVDRAYKEVAAAPRHHIASVLLRANLNVHTIFLERKSRGV 5DN6 Chain:G ((101-160)) -------------------------------------------------------------LARLRLQEL--QA----VSILT----VGKKGREQLKREYGDLFVNHVD-------------------------------------

General information: TITO was launched using: RESULT: Template: 5DN6.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain G - contact count / total energy / energy per contact / energy per residue : 85 -8612 -101.31 -226.62 target 2D structure prediction score : 0.58 Monomeric hydrophicity matching model chain G : 0.62 3D Compatibility (PKB) : -101.31 2D Compatibility (Sec. Struct. Predict.) : 0.58 1D Compatibility (Hydrophobicity) : 0.62 QMean score : 0.464

(partial model without unconserved sides chains): PDB file : Tito_5DN6.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5DN6-query.scw PDB file : Tito_Scwrl_5DN6.pdb: